Trusted by 10,000+ Scientists Since 2002. View Our Google Review, Selected Publications and 3,000+ Cited Publications at Google Scholar.

Recombinant Chikungunya virus Non-structural polyprotein, partial, Cat#RPC23292

$554.00

Cat#

RPC23292

Quantity:

Request Information

Species

Chikungunya virus (strain S27-African prototype) (CHIKV)

Source

E.coli

Tag Info

N-terminal 6xHis-tagged

Biological Activity

Not tested

Estimated Turnaround Time

15-25 business days

Gene Name

N/A

Alternative Names

Polyprotein nsP1234

Uniprot

Q8JUX6

Expression Region

2228-2474aa

AA Sequence

DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK

Sequence Info

Partial

Theoretical MW

31.1 kDa

Purity

>90% as determined by SDS-PAGE.

Storage Buffer

Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level

Not tested

Shipping Condition

Ice packs

Storage

Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Expiry Date

1 year

Research Area

Others

Restriction

For Research Use Only. Not for use in diagnostic procedures. Not for human or animal drug or food use.

Function

P123 is short-lived polyproteins, accumulating during early stage of infection. It localizes the viral replication complex to the cytoplasmic surface of modified endosomes and lysosomes. By interacting with nsP4, it starts viral genome replication into antigenome. After these early events, P123 is cleaved sequentially into nsP1, nsP2 and nsP3. This sequence of delayed processing would allow correct assembly and membrane association of the RNA polymerase complex (By similarity).

Subcellular location

Non-structural polyprotein: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Note=Located on the cytoplasmic surface of modified endosomes and lysosomes, also called cytopathic vacuoles type I (CPVI), These vacuoles contain numerous small circular invaginations (spherules) which may be the sites of RNA synthesis, SUBCELLULAR LOCATION: P123: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, SUBCELLULAR LOCATION: mRNA-capping enzyme nsP1: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host cell membrane, Peripheral membrane protein, Cytoplasmic side, Note=In the late phase of infection, the polyprotein is quickly cleaved before localization to cellular membranes, Then a fraction of nsP1 localizes to the inner surface of the plasma membrane and its filopodial extensions (By similarity), SUBCELLULAR LOCATION: Protease nsP2: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host nucleus, Note=In the late phase of infection, the polyprotein is quickly cleaved before localization to cellular membranes, Then approximately half of nsP2 is found in the nucleus (By similarity), SUBCELLULAR LOCATION: Non-structural protein 3: Host endosome membrane, Peripheral membrane protein, Cytoplasmic side, Host lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Host cytoplasm

Selected Citations Featuring Biomatik's Products & Services
Last updated 2020-01-31

 

 Click here to view more selected publications citing Biomatik's fine products & services. .

 Click Google Scholar to view 3,000+ publications citing Biomatik's fine products & services. .

To edit this page simply login to the control panel, click the Website Content tab and choose the View Web Pages option. Click Edit next to the Shipping & Returns page and you can change this text. A sample returns policy is shown below which you can edit as needed.

Returns Policy

You may return most new, unopened items within 30 days of delivery for a full refund. We'll also pay the return shipping costs if the return is a result of our error (you received an incorrect or defective item, etc.).

You should expect to receive your refund within four weeks of giving your package to the return shipper, however, in many cases you will receive a refund more quickly. This time period includes the transit time for us to receive your return from the shipper (5 to 10 business days), the time it takes us to process your return once we receive it (3 to 5 business days), and the time it takes your bank to process our refund request (5 to 10 business days).

If you need to return an item, simply login to your account, view the order using the "Complete Orders" link under the My Account menu and click the Return Item(s) button. We'll notify you via e-mail of your refund once we've received and processed the returned item.

Shipping

We can ship to virtually any address in the world. Note that there are restrictions on some products, and some products cannot be shipped to international destinations.

When you place an order, we will estimate shipping and delivery dates for you based on the availability of your items and the shipping options you choose. Depending on the shipping provider you choose, shipping date estimates may appear on the shipping quotes page.

Please also note that the shipping rates for many items we sell are weight-based. The weight of any such item can be found on its detail page. To reflect the policies of the shipping companies we use, all weights will be rounded up to the next full pound.

Integer et est tellus non bibendum est. Namcos tempus turpis at metus scelerisque placerat nulla eu sollicitudin felis. Pellentesque diam dolor elementum et lobortis at mollis ut risus. Sed faucibus ullamcorper mattis. Fusce molestie elit a loremos tempus scelerisque blandit tortor cursus. Quisque dolutpat orci ut metus malesuada lorem in interdum lectus scelerisque. Praesent eu odio ut nisi ullamcorper ultricies. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus.

Praesent at justo congue leo adipiscing
  • Integer et est tellusInteger et est tellus non bibendum est.
  • Namcos tempusNamcos tempus turpis at metus scelerisque placerat nulla eu sollicitudin felis.
  • Pellentesque diam dolorPellentesque diam dolor elementum et lobortis at mollis ut risus.
  • Sed faucibusSed faucibus ullamcorper mattis.
  • Fusce molestie elitosFusce molestie elit a loremos tempus scelerisque blandit tortor cursus.
  • Quisque dolutpat orcisQuisque dolutpat orci ut metus malesuada lorem in interdum lectus scelerisque.
  • Praesent an modioPraesent eu odio ut nisi ullamcorper ultricies.
  • Cum sociis natoque penatibusCum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus.
Top