Trusted by 10,000+ Scientists Since 2002. View Our Google Review, Selected Publications and 3,000+ Cited Publications at Google Scholar.

Recombinant Human Ras-related protein Rab-31 (RAB31), Cat#RPC22980

$302.00

Cat#

RPC22980

Quantity:

Request Information

Species

Homo sapiens (Human)

Source

E.coli

Tag Info

N-terminal GST-tagged

Biological Activity

Not tested

Estimated Turnaround Time

15-25 business days

Gene Name

RAB31

Alternative Names

Ras-related protein Rab-22B

Uniprot

Q13636

Expression Region

1-194aa

AA Sequence

MAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC

Sequence Info

Full Length

Theoretical MW

48.6 kDa

Purity

>90% as determined by SDS-PAGE.

Storage Buffer

Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level

Not tested

Shipping Condition

Ice packs

Storage

Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Expiry Date

1 year

Research Area

Signal Transduction

Restriction

For Research Use Only. Not for use in diagnostic procedures. Not for human or animal drug or food use.

Relevance

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Required for the integrity and for normal function of the Golgi apparatus and the trans-Golgi network. Plays a role in insulin-stimulated translocation of GLUT4 to the cell membrane. Plays a role in M6PR transport from the trans-Golgi network to endosomes. Plays a role in the internalization of EGFR from the cell membrane into endosomes. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.

Function

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Required for the integrity and for normal function of the Golgi apparatus and the trans-Golgi network. Plays a role in insulin-stimulated translocation of GLUT4 to the cell membrane. Plays a role in M6PR transport from the trans-Golgi network to endosomes. Plays a role in the internalization of EGFR from the cell membrane into endosomes. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis.

Subcellular location

Golgi apparatus, trans-Golgi network, Golgi apparatus, trans-Golgi network membrane, Lipid-anchor, Cytoplasmic side, Early endosome, Cytoplasmic vesicle, phagosome, Cytoplasmic vesicle, phagosome membrane, Lipid-anchor, Cytoplasmic side

Protein Families

Small GTPase superfamily, Rab family

Tissue Specificity

Highest expression in placenta and brain with lower levels in heart and lung. Not detected in liver, skeletal muscle, kidney or pancreas.

Selected Citations Featuring Biomatik's Products & Services
Last updated 2020-01-31

 

 Click here to view more selected publications citing Biomatik's fine products & services. .

 Click Google Scholar to view 3,000+ publications citing Biomatik's fine products & services. .

To edit this page simply login to the control panel, click the Website Content tab and choose the View Web Pages option. Click Edit next to the Shipping & Returns page and you can change this text. A sample returns policy is shown below which you can edit as needed.

Returns Policy

You may return most new, unopened items within 30 days of delivery for a full refund. We'll also pay the return shipping costs if the return is a result of our error (you received an incorrect or defective item, etc.).

You should expect to receive your refund within four weeks of giving your package to the return shipper, however, in many cases you will receive a refund more quickly. This time period includes the transit time for us to receive your return from the shipper (5 to 10 business days), the time it takes us to process your return once we receive it (3 to 5 business days), and the time it takes your bank to process our refund request (5 to 10 business days).

If you need to return an item, simply login to your account, view the order using the "Complete Orders" link under the My Account menu and click the Return Item(s) button. We'll notify you via e-mail of your refund once we've received and processed the returned item.

Shipping

We can ship to virtually any address in the world. Note that there are restrictions on some products, and some products cannot be shipped to international destinations.

When you place an order, we will estimate shipping and delivery dates for you based on the availability of your items and the shipping options you choose. Depending on the shipping provider you choose, shipping date estimates may appear on the shipping quotes page.

Please also note that the shipping rates for many items we sell are weight-based. The weight of any such item can be found on its detail page. To reflect the policies of the shipping companies we use, all weights will be rounded up to the next full pound.

Integer et est tellus non bibendum est. Namcos tempus turpis at metus scelerisque placerat nulla eu sollicitudin felis. Pellentesque diam dolor elementum et lobortis at mollis ut risus. Sed faucibus ullamcorper mattis. Fusce molestie elit a loremos tempus scelerisque blandit tortor cursus. Quisque dolutpat orci ut metus malesuada lorem in interdum lectus scelerisque. Praesent eu odio ut nisi ullamcorper ultricies. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus.

Praesent at justo congue leo adipiscing
  • Integer et est tellusInteger et est tellus non bibendum est.
  • Namcos tempusNamcos tempus turpis at metus scelerisque placerat nulla eu sollicitudin felis.
  • Pellentesque diam dolorPellentesque diam dolor elementum et lobortis at mollis ut risus.
  • Sed faucibusSed faucibus ullamcorper mattis.
  • Fusce molestie elitosFusce molestie elit a loremos tempus scelerisque blandit tortor cursus.
  • Quisque dolutpat orcisQuisque dolutpat orci ut metus malesuada lorem in interdum lectus scelerisque.
  • Praesent an modioPraesent eu odio ut nisi ullamcorper ultricies.
  • Cum sociis natoque penatibusCum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus.
Top