Trusted by 10,000+ Scientists Since 2002. View Our Customer Testimonials and 2,000+ Cited Publications at Google Scholar.

Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial, Cat#RPC22978

$438.00

Cat#

RPC22978

Quantity:

Request Information

Species

Homo sapiens (Human)

Source

E.coli

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Biological Activity

Not tested

Estimated Turnaround Time

15-25 business days

Gene Name

IL15RA

Alternative Names

CD_antigen: CD215

UniProt

Q13261

Expression Region

31-205aa

AA Sequence

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT

Sequence Info

Partial

Theoretical MW

23.4kDa

Purity

> 85% as determined by SDS-PAGE.

Storage Buffer

Tris-based buffer,50% glycerol

Endotoxin Level

Not tested

Shipping Condition

Ice packs

Storage

Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Expiry Date

1 year

Research Area

Cancer

Restriction

For Research Use Only. Not for use in vitro diagnostic procedures, drug use, or for administration to humans or animals.

Relevance

High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK.

Function

High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves SYK.

Subcellular Location

Membrane, Single-pass type I membrane protein, Nucleus membrane, Single-pass type I membrane protein, Note=Mainly found associated with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 5: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 6: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 7: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein, Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane, SUBCELLULAR LOCATION: Isoform 8: Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Cytoplasmic vesicle membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein

Tissue Specificity

Isoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15RA form in comparison with membrane-bound forms is present in all brain structures.

Paythway

Jak-STATsignalingpathway

To edit this page simply login to the control panel, click the Website Content tab and choose the View Web Pages option. Click Edit next to the Shipping & Returns page and you can change this text. A sample returns policy is shown below which you can edit as needed.

Returns Policy

You may return most new, unopened items within 30 days of delivery for a full refund. We'll also pay the return shipping costs if the return is a result of our error (you received an incorrect or defective item, etc.).

You should expect to receive your refund within four weeks of giving your package to the return shipper, however, in many cases you will receive a refund more quickly. This time period includes the transit time for us to receive your return from the shipper (5 to 10 business days), the time it takes us to process your return once we receive it (3 to 5 business days), and the time it takes your bank to process our refund request (5 to 10 business days).

If you need to return an item, simply login to your account, view the order using the "Complete Orders" link under the My Account menu and click the Return Item(s) button. We'll notify you via e-mail of your refund once we've received and processed the returned item.

Shipping

We can ship to virtually any address in the world. Note that there are restrictions on some products, and some products cannot be shipped to international destinations.

When you place an order, we will estimate shipping and delivery dates for you based on the availability of your items and the shipping options you choose. Depending on the shipping provider you choose, shipping date estimates may appear on the shipping quotes page.

Please also note that the shipping rates for many items we sell are weight-based. The weight of any such item can be found on its detail page. To reflect the policies of the shipping companies we use, all weights will be rounded up to the next full pound.

Integer et est tellus non bibendum est. Namcos tempus turpis at metus scelerisque placerat nulla eu sollicitudin felis. Pellentesque diam dolor elementum et lobortis at mollis ut risus. Sed faucibus ullamcorper mattis. Fusce molestie elit a loremos tempus scelerisque blandit tortor cursus. Quisque dolutpat orci ut metus malesuada lorem in interdum lectus scelerisque. Praesent eu odio ut nisi ullamcorper ultricies. Cum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus.

Praesent at justo congue leo adipiscing
  • Integer et est tellusInteger et est tellus non bibendum est.
  • Namcos tempusNamcos tempus turpis at metus scelerisque placerat nulla eu sollicitudin felis.
  • Pellentesque diam dolorPellentesque diam dolor elementum et lobortis at mollis ut risus.
  • Sed faucibusSed faucibus ullamcorper mattis.
  • Fusce molestie elitosFusce molestie elit a loremos tempus scelerisque blandit tortor cursus.
  • Quisque dolutpat orcisQuisque dolutpat orci ut metus malesuada lorem in interdum lectus scelerisque.
  • Praesent an modioPraesent eu odio ut nisi ullamcorper ultricies.
  • Cum sociis natoque penatibusCum sociis natoque penatibus et magnis dis parturient montes, nascetur ridiculus mus.
Top